HORDB

ID: hor002345
Uniprot ID: P17685
Protein name: Egg-laying hormone
Gene name: ELH1
Organism: Aplysia parvula (Dwarf sea hare)
Family: Molluscan ELH family
Source: animal
Expression: Bag cell neurons.
Disease: NA
Comments: NA
Taxonomy: Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: ISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNK
Length: 36
Propeptide: MGRPSYRSAAAISLLMCLILSALCASSESAVVHGSSFATERAVKSSPYLVLSPADEMVGMSTANEAFDKSPSYYDDDDDDFVKNEKRRLRFHKRRIRFNKRPQEVSGLKPVMMSRASASADENSLFDLYNTDGAMYQRDLRAPRLRFYSLRKRAAGDEDKSEENNPETESHSRRKRSALTPSIRSLRSSLESGIAKRISINQDLKAIADMLIVEQKQEREKYLADLRQRLLNKGKRSSEVALAASDKGDEERELLNTLSNLLE
Signal peptide: MGRPSYRSAAAISLLMCLILSALCASSES
Modification: T36 Lysine amide
Glycosylation: NA
Mutagenesis: NA

Function: ELH acts as a neurotransmitter locally, upon neurons of the abdominal ganglion and as a hormone by diffusing into the circulating hemolymph and modulating the activity of other organs. It specifically causes contraction of smooth muscle in the ovotestis and expulsion of the egg string.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002345_AF2.pdb

hor002345_ESM.pdb

Mass:	492254	Formula:	C188H323N55O57S
Absent amino acids:	CFGHPTW	Common amino acids:	L
pI:	9.19	Basic residues:	7
Polar residues:	4	Hydrophobic residues:	14
Hydrophobicity:	-58.06	Boman Index:	-9151
Half-Life:	20 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	124.72
Instability Index:	3810	Extinction Coefficient cystines:	1490
Absorbance 280nm:	42.57